EveryEvent Nashville

Ver Todos los Events

Music City

events

Concerts & Live Music
Festivals
Sports & Recreation
Food & Drink
Arts & Culture
Community
Family & Kids
Nightlife
Comedy
Theater
Destinos Populares
BaliSedonaLos AngelesCosta RicaNew YorkSan FranciscoAustinMiamiJoshua TreeTulum
Ver Todas las CategoríasVer Todos los Destinos

Explorar Todas las Características

Herramientas poderosas para hacer crecer tus eventos

Características de la Plataforma

Precios Dinámicos Inteligentes
Categorías de Entradas
Asientos Asignados
Recuperación de Carritos
Recuperación de Visitantes
Donaciones y Escala Móvil
Motor de Afiliados
Escáner de Entradas
Códigos de Cupón
Preguntas Personalizadas
Compartir Entradas
Ventas Adicionales
Análisis e Informes
Secuencias de Email
Lista de Espera / Notificar / Recordar
Explorar
Discovery HubArtists & PerformersVenuesKnowledge Base
Ver Todas las CaracterísticasSobre Nosotros
PreciosBlog
Saved events
Ver Todos los Eventos

events

Concerts & Live MusicFestivalsSports & RecreationFood & DrinkArts & CultureCommunityFamily & KidsNightlife

Destinos Populares

BaliSedonaLos AngelesCosta RicaNew YorkSan Francisco

Explorar

Discovery HubArtists & PerformersVenuesKnowledge Base

Características de la Plataforma

Precios Dinámicos InteligentesCategorías de EntradasAsientos AsignadosRecuperación de CarritosRecuperación de VisitantesDonaciones y Escala MóvilMotor de AfiliadosEscáner de EntradasCódigos de CupónPreguntas PersonalizadasCompartir EntradasVentas AdicionalesAnálisis e InformesSecuencias de EmailLista de Espera / Notificar / Recordar
Ver Todas las CaracterísticasSobre Nosotros
PreciosBlog
Iniciar sesiónRegistrarseOrganizadores de Eventos
  • Browse All Events
  • Concerts & Live Music
  • Festivals
  • Sports & Recreation
  • Food & Drink
  • Arts & Culture
  • Community
  • Family & Kids
  • Nightlife
  • Todas las Categorías →
  • Memphis
  • Chattanooga
  • Knoxville
  • Louisville
  • Atlanta
  • All Destinations →
  • For Promoters
  • For Artists
  • For Venues
  • For Festivals
  • For Event Spaces
  • For Nonprofits
  • For Bloggers
  • For Speakers
  • Brand Ambassador
  • Case Studies
  • Red de +350K Compradores
  • Recuperación de Carritos
  • Precios Dinámicos Inteligentes
  • Categorías de Entradas
  • Eventos Recurrentes
  • Asientos Asignados
  • Motor de Afiliados
  • Lista de Espera / Notificar
  • Escáner de Entradas
  • Widget Embebido
  • Event Syndication
  • Message Center
  • Integrations
  • Reports
  • Todas las Características →
  • Acerca de
  • The Ecosystem
  • Blog
  • Glosario
  • Inspiration
  • Centro de Ayuda
  • Contacto
  • Documentación API
  • Recursos de Marca
  • Carreras
  • Prensa
  • Términos de Servicio
  • Política de Privacidad

Events

  • Browse All Events
  • Concerts & Live Music
  • Festivals
  • Sports & Recreation
  • Food & Drink
  • Arts & Culture
  • Community
  • Family & Kids
  • Nightlife
  • Todas las Categorías →

Getaways

  • Memphis
  • Chattanooga
  • Knoxville
  • Louisville
  • Atlanta
  • All Destinations →

For Organizers

  • For Promoters
  • For Artists
  • For Venues
  • For Festivals
  • For Event Spaces
  • For Nonprofits
  • For Bloggers
  • For Speakers
  • Brand Ambassador
  • Case Studies

Características

  • Red de +350K Compradores
  • Recuperación de Carritos
  • Precios Dinámicos Inteligentes
  • Categorías de Entradas
  • Eventos Recurrentes
  • Asientos Asignados
  • Motor de Afiliados
  • Lista de Espera / Notificar
  • Escáner de Entradas
  • Widget Embebido
  • Event Syndication
  • Message Center
  • Integrations
  • Reports
  • Todas las Características →

Empresa

  • Acerca de
  • The Ecosystem
  • Blog
  • Glosario
  • Inspiration
  • Centro de Ayuda
  • Contacto
  • Documentación API
  • Recursos de Marca
  • Carreras
  • Prensa
  • Términos de Servicio
  • Política de Privacidad
EveryEvent
© 2026 EveryEvent Nashville. Todos los derechos reservados.
Glossary›Avidya

Glossary

Avidya

Fundamental ignorance or misperception of reality's true nature—the root cause of suffering in Buddhism, Hinduism, and Yoga philosophy.

What is Avidya?

Avidyā is a Vedic Sanskrit compound of “a” (not) and “vidya” (knowledge), meaning “not vidya.” The word vidya is derived from the Sanskrit root Vid, which means “to know, to perceive, to see, to understand.” Avidya is a Sanskrit term used in both Buddhism and Hinduism to denote delusion or ignorance.

What is avidya in practical terms? Avidya is not lack of information, but a “more deep seated misperception of reality.” While avidya found in Indian philosophies is translated as “ignorance,” this is a mistranslation because avidya means more than ignorance—the term includes not only ignorance out of darkness, but also obscuration, misconceptions, mistaking illusion to be reality or impermanent to be permanent or suffering to be bliss or non-self to be self (delusions). Gethin calls avidya as ‘positive misconception’, not mere absence of knowledge.

The avidya meaning differs between traditions. The Indian religions disagree on the details—Hinduism considers denial and misconceptions of Atman (soul, self) as a form of avidya, while Buddhism considers the denial and misconceptions of An-atman (non-soul, non-self) as a form of avidya.

Origins & Lineage

The Vid-related terms appear extensively in the Rigveda and other Vedas. In the Vedas avidyā means ignorance of ritual and moral obligations and so implies absence of knowledge rather than an ontological condition of bondage. In the Upaniṣads it comes to mean spiritual delusion and the non-knowledge of Brahman.

Avidya is described in the Yoga Sutras by Patanjali, as the first of the five kleshas, the knots of affliction, and the productive field of all them that follow. In Yoga Sutras II.5, Patanjali defines Avidya as confusing the nature of the soul with the body. The kleshas are defined in the Yoga Sutras, written between 200 and 500 B.C. by the Indian sage Patanjali.

In Buddhism, avidyā is identified as the first of the twelve links of dependent origination (twelve nidanas)—a sequence of links that describe why a being reincarnates and remains bound within the samsara, a cycle of repeated births and deaths in six realms of existence. This theory, presented in Samyutta Nikaya II.2–4 and Digha Nikaya II.55–63, asserts that rebirth, re-aging and re-death ultimately arise through a series of twelve links or nidanas ultimately rooted in Avidyā, and the twelfth step Jarāmaraṇa triggers the dependent origination of Avidyā, recreating an unending cycle of dukkha (suffering, pain, unsatisfactoriness).

In Sāṃkhya-yoga ignorance, which is the cause of bondage and suffering, is regarded as the non-discrimination of the individual self (puruṣa) from matter (prakṛti) in which it appears to be entangled. For Advaita Vedānta bondage is similarly due to beginningless ignorance which, in contrast to Sāṃkhya, is the creation of distinctions where none exist; in reality there being only Brahman.

How Avidya Operates

Avidya is the first of the kleshas listed because it is the basis for the others. These kleshas—Avidya (ignorance), Asmita (egoism), Raga (attachment), Dvesha (aversion), and Abhinivesha (fear of death)—appear in our thoughts, actions, and emotions.

The effect of avidya is to suppress the real nature of things and present something else in its place. In effect it is not different from Maya (pronounced Māyā) or illusion. Avidya relates to the individual Self (Ātman), while Maya is an adjunct of the cosmic Self (Brahman).

One relates to the Anatta (Anatman) doctrine, that is ignorance or misconceptions about “Self”, when in reality there is only non-Self according to Buddhism. The second relates to Anicca doctrine, that is ignorance or misconceptions about “permanence”, when the nature of reality is impermanence. In the Suttanta literature, this ignorance refers to the non-knowledge of the Four Noble Truths.

Avidya Today

Seekers encounter avidya through multiple pathways. In modern yoga studios, teachers reference avidya when discussing the five kleshas in philosophy sessions alongside asana practice. Vipassana meditation retreats explicitly train students to recognize avidya through direct observation of impermanence, dissatisfaction, and non-self.

Advaita Vedanta satsangs focus on self-inquiry practices that expose avidya’s concealment of one’s true nature as Brahman. Buddhist sanghas study the twelve nidanas to understand how ignorance perpetuates cyclic existence. Yoga teacher trainings typically dedicate substantial time to Patanjali’s kleshas, with avidya as the foundational affliction.

Contemporary meditation apps and dharma podcasts frequently address avidya’s manifestations—mistaking thoughts for self, confusing temporary circumstances for permanent identity, or seeking lasting happiness in impermanent phenomena.

Common Misconceptions

Avidya is not simple lack of education or information. This ignorance, “the ignorance veiling our true self and the truth of the world”, is not lack of erudition; it is ignorance about the nature of ‘Being’ (Sat). It is a limitation that is natural to human sensory or intellectual apparatus.

Avidya is not a moral failing or sin. It is a key concept in Buddhism, wherein Avidya about the nature of reality, rather than sin, is considered the basic root of Dukkha. It describes a perceptual condition, not ethical wrongdoing.

Avidya is not identical to maya, though related. Avidya is similar to the concept of maya, the difference being that maya is universal illusion, while avidya is individual ignorance or delusion.

Avidya is not merely philosophical abstraction. In the Yoga Sutras, Patanjali describes avidya as mistaking the impermanent for permanent, confusing pleasure with lasting happiness, and misidentifying the self. It manifests concretely in daily life—believing your job title defines you, expecting relationships to never change, or treating passing emotions as permanent states.

How to Begin

To overcome avidya, the Yoga Sutras suggest these methods: Yogic asanas and breathing exercises. Self-examination through meditation. Spiritual detachment from and observation of one’s actions.

For direct study, begin with Patanjali’s Yoga Sutras, specifically Book II (Sadhana Pada), sutras 3-9, which outline the five kleshas. The Sri Swami Satchidananda translation offers accessible commentary. For Buddhist perspective, study the twelve nidanas in the Samyutta Nikaya or accessible commentaries by Bhikkhu Bodhi.

Practical entry points include: attending Vipassana meditation retreats that systematically train observation of impermanence and non-self; working with an Advaita Vedanta teacher on self-inquiry (atma vichara) practices; or enrolling in comprehensive yoga teacher training that includes in-depth philosophy study. Many practitioners find clarity through combining study of source texts with consistent meditation practice under qualified guidance.

Related terms

kleshamayaatmansamsaravipassanaadvaita
All termsDiscover